PDB entry 1emt

View 1emt on RCSB PDB site
Description: fab antibody fragment of an c60 antifullerene antibody
Deposited on 2000-03-17, released 2000-11-01
The last revision prior to the SCOP 1.59 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1emtH (H:)
    qvhlqesgpelvrpgasvkiscktsgyvfssswmnwvkqrpgqglkwigriypgngntny
    nekfkgkatltadkssntaymqlssltsvdsavyfcatssaywgqgtlltvsaakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emtH (H:)
    qvhlqesgpelvrpgasvkiscktsgyvfssswmnwvkqrpgqglkwigriypgngntny
    nekfkgkatltadkssntaymqlssltsvdsavyfcatssaywgqgtlltvsaakttpps
    vyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
    sprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emtL (L:)
    diqmtqttsslsaslgdrvtfscsasqdisnylnwyqqkpdgtiklliyytsslrsgvps
    rfsgsgsgtdysltinnlepediatyfcqqysrlpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec