PDB entry 1emo

View 1emo on RCSB PDB site
Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor-like domains, 22 structures
Class: matrix protein
Keywords: extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, egf-like domain, human fibrillin-1 fragment, matrix protein
Deposited on 1996-08-05, released 1996-12-23
The last revision prior to the SCOP 1.73 freeze date was dated 1996-12-23, with a file datestamp of 2007-06-04.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fibrillin
  Species: HOMO SAPIENS
  Gene: FBN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35555 (0-81)
    • conflict (34)
  Domains in SCOP 1.73: d1emoa1, d1emoa2
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1emoA (A:)
  savdmdeckepdvckhgqcintdgsyrcecpfgyilagnecvdtdecsvgnpcgngtckn
  viggfectceegfepgpmmtce