PDB entry 1emd

View 1emd on RCSB PDB site
Description: crystal structure of a ternary complex of escherichia coli malate dehydrogenase, citrate and nad at 1.9 angstroms resolution
Class: oxidoreductase(nad(a)-choh(d))
Keywords: oxidoreductase(nad(a)-choh(d))
Deposited on 1993-03-25, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • conflict (79)
      • conflict (306)
    Domains in SCOPe 2.07: d1emda1, d1emda2
  • Heterogens: CIT, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emdA (A:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvrrkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk