PDB entry 1el1

View 1el1 on RCSB PDB site
Description: x-ray crystal structure analysis of canine milk lysozyme (holo-type)
Class: hydrolase
Keywords: Calcium binding lysozyme, Holo-form, C-type lysozyme, HYDROLASE
Deposited on 2000-03-13, released 2001-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Canis lupus [TaxId:9615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81708 (1-129)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1el1a1, d1el1a2
  • Chain 'B':
    Compound: Lysozyme C
    Species: Canis lupus [TaxId:9615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81708 (1-129)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1el1b1, d1el1b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1el1A (A:)
    skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1el1B (B:)
    skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl