PDB entry 1ek8

View 1ek8 on RCSB PDB site
Description: crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Class: translation
Keywords: ribosome, translation factor, t-RNA mimicry, coiled coil
Deposited on 2000-03-07, released 2001-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2001-03-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosome recycling factor
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A805 (0-184)
  Domains in SCOP 1.73: d1ek8a_
• Heterogens: HG, DEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ek8A (A:)
  misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
  dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
  aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
  elmqf