PDB entry 1ek8

View 1ek8 on RCSB PDB site
Description: crystal structure of the ribosome recycling factor (rrf) from escherichia coli
Deposited on 2000-03-07, released 2001-03-07
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ek8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ek8A (A:)
    misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
    dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
    aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
    elmqf