PDB entry 1ejo

View 1ejo on RCSB PDB site
Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.
Deposited on 2000-03-03, released 2000-03-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ejoH (H:)
    qmlvesggdlvkpggslklscaasgftfssytmswvrqtpekrlewvatissggaytyyp
    dsvkgrftisddnaestlylqmsslrsedtamyycvrrafdsdvgfaswghrtlvtvsaa
    kttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ejoH (H:)
    qmlvesggdlvkpggslklscaasgftfssytmswvrqtpekrlewvatissggaytyyp
    dsvkgrftisddnaestlylqmsslrsedtamyycvrrafdsdvgfaswghrtlvtvsaa
    kttapsvyplapvcgsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ejoL (L:)
    divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnra