PDB entry 1ej7

View 1ej7 on RCSB PDB site
Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions
Deposited on 2000-03-01, released 2000-03-15
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.149
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej7L (L:)
    kdykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsl
    drykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrled
    lrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggl
    dftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfa
    relgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlaka
    lrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpv
    asggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdl
    aqegneiireackwspelaaacevwkeivfnfaavdv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej7S (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy