PDB entry 1ej3

View 1ej3 on RCSB PDB site
Description: crystal structure of aequorin
Deposited on 2000-02-29, released 2000-05-31
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ej3a_
  • Chain 'B':
    Domains in SCOP 1.57: d1ej3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej3A (A:)
    ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
    eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
    aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
    lyggavp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ej3B (B:)
    ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
    eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
    aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
    lyggavp