PDB entry 1eia

View 1eia on RCSB PDB site
Description: x-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Deposited on 1998-07-15, released 1999-02-16
The last revision prior to the SCOP 1.61 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eia_ (-)
tprgyttwvntiqtngllneasqnlfgilsvdctseemnafldvvpgqagqkqilldaid
kiaddwdnrhplpnaplvappqgpipmtarfirglgvprerqmepafdqfrqtyrqwiie
amsegikvmigkpkaqnirqgakepypefvdrllsqikseghpqeiskfltdtltiqnan
eecrnamrhlrpedtleekmyacrdig