PDB entry 1ei5

View 1ei5 on RCSB PDB site
Description: crystal structure of a d-aminopeptidase from ochrobactrum anthropi
Deposited on 2000-02-24, released 2000-10-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-10-04, with a file datestamp of 2000-10-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ei5A (A:)
    kfdtsaleafvrhipqnykgpggvvavvkdgevvlqhawgfadlrtrtpmtldtrmpics
    vskqftcavlldavgepellddaleayldkfederpavrdlcnnqsglrdywalsvlcga
    dpegvflpaqaqsllrrlktthfepgshysycngnfriladlieahtgrtlvdilserif
    apagmkraelisdtalfdectgyegdtvrgflpatnriqwmgdagicaslndmiaweqfi
    datrddesglyrrlsgpqtfkdgvaapygfglnlhetggkrltghggalrgwrcqrwhca
    derlstiamfnfeggasevafklmnialgvsssevsrveadsawfgswlddetglvlsle
    daghgrmkarfgtspemmdvvsanearsavttirrdgetielvrasenlrlsmkrvkgea
    khdiigryhsdeldadlllvseggaiygafegflgksdmyplysvgsdvwllpvqrsmda
    pspgewklvfrrddkgeitglsvgcwlargveyrrvqp