PDB entry 1ei1

View 1ei1 on RCSB PDB site
Description: dimerization of e. coli dna gyrase b provides a structural mechanism for activating the atpase catalytic center
Deposited on 2000-02-23, released 2000-03-31
The last revision prior to the SCOP 1.71 freeze date was dated 2000-03-31, with a file datestamp of 2000-03-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.166
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ei1A (A:)
    snssdsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiiv
    tihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvs
    vvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvte
    feyeilakrlrelsfldsgvsirlrdkrdgkedhfhyeggikafveylnknktpihpnif
    yfstekdgigvevalqwndgfqeniycftnnipqrdggthlagfraamtrtlnaymdkeg
    yskkakvsatgddaregliavvsvkvpdpkfssqtkdklvssevksaveqqmnellaeyl
    lenptdakivvgkiidaarareaarraremt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ei1B (B:)
    snssdsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiiv
    tihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvs
    vvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvte
    feyeilakrlrelsfldsgvsirlrdkrdgkedhfhyeggikafveylnknktpihpnif
    yfstekdgigvevalqwndgfqeniycftnnipqrdggthlagfraamtrtlnaymdkeg
    yskkakvsatgddaregliavvsvkvpdpkfssqtkdklvssevksaveqqmnellaeyl
    lenptdakivvgkiidaarareaarraremt