PDB entry 1ehx

View 1ehx on RCSB PDB site
Description: nmr solution structure of the last unknown module of the cellulosomal scaffoldin protein cipc of clostridum cellulolyticum
Deposited on 2000-02-23, released 2000-11-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1ehxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ehxA (A:)
  mqdptinptsisakagsfadtkitltpngntfngiselqssqytkgtnevtllasylntl
  penttktltfdfgvgtknpkltitvlpkdipgle