PDB entry 1ehk

View 1ehk on RCSB PDB site
Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus
Deposited on 2000-02-21, released 2001-02-21
The last revision prior to the SCOP 1.61 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ehkA (A:)
    aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
    vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
    tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
    flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
    qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
    ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
    vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
    imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
    srerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghl
    npvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehkA (A:)
    aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
    vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
    tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
    flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
    qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
    ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
    vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
    imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
    srlaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghlnpvpg
    wrlw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehkB (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehkC (C:)
    eekpkgalavilvltltilvfwlgvyavffarg