PDB entry 1ehk

View 1ehk on RCSB PDB site
Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus
Class: oxidoreductase
Keywords: cytochrome-c oxidase, membrane protein, Thermus thermophilus, OXIDOREDUCTASE
Deposited on 2000-02-21, released 2001-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ba3-type cytochrome-c oxidase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ehka_
  • Chain 'B':
    Compound: ba3-type cytochrome-c oxidase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ehkb1, d1ehkb2
  • Chain 'C':
    Compound: ba3-type cytochrome-c oxidase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ehkc_
  • Heterogens: BNG, CU, HEM, HAS, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ehkA (A:)
    mavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllp
    fvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvva
    alpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtp
    lvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwl
    lpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsv
    ltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipgg
    aggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrl
    glavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllva
    lllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvl
    aygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehkA (A:)
    aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
    vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
    tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
    flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
    qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
    ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
    vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
    imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
    srlaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghlnpvpg
    wrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ehkB (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehkB (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ehkC (C:)
    eekpkgalavilvltltilvfwlgvyavffarg