PDB entry 1eh9

View 1eh9 on RCSB PDB site
Description: crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
Class: hydrolase
Keywords: trehalose, trehalohydrolase, Sulfolobus solfataricus, alpha/beta barrel, calcium binding, covalent dimer, crystal structure
Deposited on 2000-02-19, released 2001-02-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosyltrehalose trehalohydrolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1eh9a1, d1eh9a2, d1eh9a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eh9A (A:)
    tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
    ddaseipdpasryqpegvhgpsqiiqeskefnnetflkkedliiyeihvgtftpegtfeg
    virkldylkdlgitaieimpiaqfpgkrdwgydgvylyavqnsyggpegfrklvdeahkk
    glgvildvvynhvgpegnymvklgpyfsqkyktpwgltfnfddaesdevrkfilenveyw
    ikeynvdgfrldavhaiidtspkhileeiadvvhkynriviaesdlndprvvnpkekcgy
    nidaqwvddfhhsihayltgerqgyytdfgnlddivksykdvfvydgkysnfrrkthgep
    vgeldgcnfvvyiqnhdqvgnrgkgeriiklvdresykiaaalyllspyipmifmgeeyg
    eenpfyffsdfsdskliqgvregrkkengqdtdpqdestfnasklswkideeifsfykil
    ikmrkelsiacdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpq
    hieegkyefdkgfalykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eh9A (A:)
    tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
    ddaseipdpasryqpegvhgpsqiiqeskefnnetflkkedliiyeihvgtftpegtfeg
    virkldylkdlgitaieimpiaqfpgkrdwgydgvylyavqnsyggpegfrklvdeahkk
    glgvildvvynhvgpegnymvklgpyfsqkyktpwgltfnfddaesdevrkfilenveyw
    ikeynvdgfrldavhaiidtspkhileeiadvvhkynriviaesdlndprvvnpkekcgy
    nidaqwvddfhhsihayltgerqgyytdfgnlddivksykdvfvydgkysnfrrkthgep
    vgeldgcnfvvyiqnhdqvgnrgkgeriiklvdresykiaaalyllspyipmifmgeeyg
    eenpfyffsdfsdskliqgvregrkkengqdtdpqdestfnasklswkideeifsfykil
    ikmrkelsiacdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpq
    hieegkyefdkgfalyk