PDB entry 1ego

View 1ego on RCSB PDB site
Description: nmr structure of oxidized escherichia coli glutaredoxin: comparison with reduced e. coli glutaredoxin and functionally related proteins
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1ego__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ego_ (-)
  mqtvifgrsgcpycvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
  qifvdqqhiggytdfaawvkenlda