PDB entry 1egj

View 1egj on RCSB PDB site
Description: domain 4 of the beta common chain in complex with an antibody
Deposited on 2000-02-15, released 2001-02-15
The last revision prior to the SCOP 1.65 freeze date was dated 2001-02-15, with a file datestamp of 2001-02-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egjA (A:)
    iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm
    alpalepstrywarvrvrtsrtgyngiwsewsearswdtes
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egjH (H:)
    evqlqqsgpelvkpgtsvkmsckasgytftdyymkwvkhshgkslewigdinpsnggtly
    nqkfkgkatltvdkssstasmqlsrltsedsavyycsrgdgihggfaywgqgttvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkivpqv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egjL (L:)
    nivltqspaslavslgqratiscranesvysygdsfmhwyqqkpgqppklliylasnlas
    gvparfsgsgsrtdftltidpvetddaatyycqqnnedpwtfgggtkleikrgdaaptvs
    ifppsseqltsggasvvcflnnfypkdanvawkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr