PDB entry 1egd

View 1egd on RCSB PDB site
Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase
Deposited on 1996-04-11, released 1997-06-16
The last revision prior to the SCOP 1.57 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egdA (A:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egdB (B:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egdC (C:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egdD (D:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyggtsqiqrlivarehidkykn