PDB entry 1ega

View 1ega on RCSB PDB site
Description: crystal structure of a widely conserved gtpase era
Deposited on 1998-12-01, released 1999-07-12
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-12, with a file datestamp of 1999-07-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.243
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egaA (A:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egaB (B:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg