PDB entry 1eg9

View 1eg9 on RCSB PDB site
Description: naphthalene 1,2-dioxygenase with indole bound in the active site.
Deposited on 2000-02-15, released 2000-05-24
The last revision prior to the SCOP 1.67 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eg9A (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg9A (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltktt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eg9B (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg9B (B:)
    miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
    vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
    nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
    erilqthnlmvfl