PDB entry 1eg5

View 1eg5 on RCSB PDB site
Description: nifs-like protein
Deposited on 2000-02-13, released 2000-04-02
The last revision prior to the SCOP 1.71 freeze date was dated 2000-04-02, with a file datestamp of 2000-04-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1eg5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1eg5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eg5A (A:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvstssactskderlrhvldamgvdrriaqgairislckyntee
    evdyflkkieeilsfldltgnnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg5A (A:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvsthvldamgvdrriaqgairislckynteeevdyflkkieei
    lsfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eg5B (B:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvstssactskderlrhvldamgvdrriaqgairislckyntee
    evdyflkkieeilsfldltgnnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eg5B (B:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvstrhvldamgvdrriaqgairislckynteeevdyflkkiee
    ilsfl