PDB entry 1efu

View 1efu on RCSB PDB site
Description: elongation factor complex ef-tu/ef-ts from escherichia coli
Deposited on 1996-07-09, released 1997-01-11
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.175
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efuA (A:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efuA (A:)
    kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk
    nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
    emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeperaidkp
    fllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrklldegr
    agenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtpffkgyrpq
    fyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggrtvgagvva
    kvls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efuB (B:)
    aeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgv
    iktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerva
    lvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefi
    kpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepskt
    vgqllkehnaevtgfirfevgegiekvetdfaaevaamskqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1efuC (C:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efuC (C:)
    kphvnvgtighvdhgkttltaaittvlaktyggatshveydtptrhyahvdcpghadyvk
    nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
    emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeperaidkp
    fllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrklldegr
    agenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtpffkgyrpq
    fyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggrtvgagvva
    kvls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efuD (D:)
    aeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgv
    iktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerva
    lvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefi
    kpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepskt
    vgqllkehnaevtgfirfevgegiekvetdfaaevaamskqs