PDB entry 1efq

View 1efq on RCSB PDB site
Description: Q38D mutant of LEN
Deposited on 2000-02-09, released 2001-02-09
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-09, with a file datestamp of 2001-02-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.23
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1efqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efqA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqdkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik