PDB entry 1efm

View 1efm on RCSB PDB site
Description: structure of the GDP domain of ef-tu and location of the amino acids homologous to ras oncogene proteins
Class: elongation factor
Keywords: elongation factor
Deposited on 1987-05-29, released 1987-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1efma1
  • Heterogens: MG, GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efmA (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaargitintshveydtptr
    hyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivfl
    nkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagf
    ldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkst
    ctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesevyilskd
    eggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrf
    aireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efmA (A:)
    vnvgtighvdhgkttltaaittvlaktytintshveydtptrhyahvdcpghadyvknmi
    tgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelveme
    vrellsqydfpgddtpivrgsalkalegdaeweakile