PDB entry 1efm

View 1efm on RCSB PDB site
Description: structure of the gdp domain of ef-tu and location of the amino acids homologous to ras oncogene proteins
Deposited on 1987-05-29, released 1987-07-16
The last revision prior to the SCOP 1.57 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1efm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1efm_ (-)
    vnvgtighvdhgkttltaaittvlaktyggaarxxxxxxxxxxxxxxgitintshveydt
    ptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyii
    vflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efm_ (-)
    vnvgtighvdhgkttltaaittvlaktytintshveydtptrhyahvdcpghadyvknmi
    tgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelveme
    vrellsqydfpgddtpivrgsalkalegdaeweakile