PDB entry 1efh

View 1efh on RCSB PDB site
Description: crystal structure of the human hydroxysteroid sulfotransferase in the presence of pap
Deposited on 2000-02-08, released 2000-09-06
The last revision prior to the SCOP 1.57 freeze date was dated 2000-09-06, with a file datestamp of 2000-09-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1efha_
  • Chain 'B':
    Domains in SCOP 1.57: d1efhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efhA (A:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
    qllrkgvsgdwknhftvaqaedfdklfqekmadlprklaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efhA (A:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdql
    lrkgvsgdwknhftvaqaedfdklfqekmadlprklaaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efhB (B:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
    qllrkgvsgdwknhftvaqaedfdklfqekmadlprklaaaleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efhB (B:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvkaql
    lrkgvsgdwknhftvaqaedfdklfqekmadlprklaaaleh