PDB entry 1efg

View 1efg on RCSB PDB site
Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution
Deposited on 1994-10-17, released 1995-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.267
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efgA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efgA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihktaavttcfwkdhriniidt
    pghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktga
    dlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipee
    yldnareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsal
    knkgvqllldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgr
    ltfirvysgtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketi
    tgdtlvgedaprvilesiegkpqvayretitkpvdvegkfirqtggrgqyghvkikvepl
    prgsgfefvnaivggvipkeyipavqkgieeamqsgpligfpvvdikvtlydgsyhevds
    semafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvigdlnarrgqilgmepr
    gnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqeklik