PDB entry 1efc

View 1efc on RCSB PDB site
Description: intact elongation factor from e.coli
Class: RNA binding protein
Keywords: transport and protection protein, RNA binding protein
Deposited on 1998-11-24, released 1999-03-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (elongation factor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1efca1, d1efca2, d1efca3
  • Chain 'B':
    Compound: protein (elongation factor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1efcb1, d1efcb2, d1efcb3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1efcA (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efcA (A:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1efcB (B:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1efcB (B:)
    tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
    eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
    pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
    ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
    ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
    vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
    mddglrfaireggrtvgagvvakvls