PDB entry 1eeu

View 1eeu on RCSB PDB site
Description: m4l/y(27d)d/q89d/t94h mutant of len
Deposited on 2000-02-03, released 2001-02-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-03, with a file datestamp of 2001-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1eeua_
  • Chain 'B':
    Domains in SCOP 1.59: d1eeub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eeuA (A:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtklei
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eeuB (B:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycdqyyshpysfgqgtkleik