PDB entry 1eeq

View 1eeq on RCSB PDB site
Description: M4L/Y(27D)D/T94H Mutant of LEN
Deposited on 2000-02-01, released 2001-02-01
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-01, with a file datestamp of 2001-02-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.211
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1eeqa_
  • Chain 'B':
    Domains in SCOP 1.57: d1eeqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eeqA (A:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eeqB (B:)
    divltqspdslavslgeratinckssqsvldssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyshpysfgqgtkleik