PDB entry 1eeo

View 1eeo on RCSB PDB site
Description: crystal structure of protein tyrosine phosphatase 1b complexed with acetyl-e-l-e-f-ptyr-m-d-y-e-nh2
Class: hydrolase/hydrolase substrate
Keywords: hydrolase, phosphorylation, inhibition, hydrolase-hydrolase substrate complex
Deposited on 2000-02-01, released 2001-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase 1b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031
      • engineered (214)
    Domains in SCOPe 2.07: d1eeoa_
  • Chain 'B':
    Compound: acetyl-e-l-e-f-ptyr-m-d-y-e-nh2 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1EEO
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eeoA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eeoA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhssagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

  • Chain 'B':
    No sequence available.