PDB entry 1edm

View 1edm on RCSB PDB site
Description: epidermal growth factor-like domain from human factor ix
Deposited on 1996-03-21, released 1996-10-14
The last revision prior to the SCOP 1.59 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.157
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.59: d1edmb_
  • Chain 'C':
    Domains in SCOP 1.59: d1edmc_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edmB (B:)
    vdgdqcesnpclnggsckddinsyecwcpfgfegkncel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edmC (C:)
    vdgdqcesnpclnggsckddinsyecwcpfgfegkncel