PDB entry 1ecx

View 1ecx on RCSB PDB site
Description: nifs-like protein
Class: transferase
Keywords: plp-dependent enzymes, iron-sulfur-cluster synthesis, c-s beta lyase, TRANSFERASE
Deposited on 2000-01-26, released 2000-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ecxa_
  • Chain 'B':
    Compound: aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X218 (0-End)
      • see remark 999 (331)
    Domains in SCOPe 2.07: d1ecxb_
  • Heterogens: PLP, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ecxA (A:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvstssactskderlrhvldamgvdrriaqgairislckyntee
    evdyflkkieeilsfldltgnnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecxA (A:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvsthvldamgvdrriaqgairislckynteeevdyflkkieei
    lsfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ecxB (B:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvstssactskderlrhvldamgvdrriaqgairislckyntee
    evdyflkkieeilsfldltgnnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ecxB (B:)
    mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
    pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
    vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
    tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
    vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
    nirgstlqnllsgygiyvstrhvldamgvdrriaqgairislckynteeevdyflkkiee
    ilsfl