PDB entry 1eci

View 1eci on RCSB PDB site
Description: ectatomin (water solution, nmr 20 structures)
Deposited on 1995-08-16, released 1995-12-07
The last revision prior to the SCOP 1.59 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ecia_
  • Chain 'B':
    Domains in SCOP 1.59: d1ecib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eciA (A:)
    gvipkkiwetvcptvepwakkcsgdiatyikrecgkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eciB (B:)
    wstivklticptlksmakkcegsiatmikkkcdk