PDB entry 1ec6
View 1ec6 on RCSB PDB site
Description: crystal structure of nova-2 kh3 k-homology RNA-binding domain bound to 20-mer RNA hairpin
Class: RNA binding protein/RNA
Keywords: KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on
2000-01-25, released
2000-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-02-03, with a file datestamp of
2021-01-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: RNA-binding protein nova-2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ec6a1, d1ec6a2 - Chain 'B':
Compound: RNA-binding protein nova-2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ec6b1, d1ec6b2 - Chain 'C':
Compound: 20-mer RNA hairpin
Species: synthetic, synthetic
- Chain 'D':
Compound: 20-mer RNA hairpin
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ec6A (A:)
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnpqkv
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1ec6B (B:)
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnpqkv
Sequence, based on observed residues (ATOM records): (download)
>1ec6B (B:)
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnp
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.