PDB entry 1ebk

View 1ebk on RCSB PDB site
Description: structural and kinetic analysis of drug resistant mutants of hiv-1 protease
Deposited on 2000-01-24, released 2000-07-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.55: d1ebkc_
  • Chain 'D':
    Domains in SCOP 1.55: d1ebkd_
  • Chain 'E':
    Domains in SCOP 1.55: d1ebke_
  • Chain 'F':
    Domains in SCOP 1.55: d1ebkf_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebkC (C:)
    pqitlwkqplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebkD (D:)
    pqitlwkqplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebkE (E:)
    pqitlwkqplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebkF (F:)
    pqitlwkqplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf