PDB entry 1eap

View 1eap on RCSB PDB site
Description: crystal structure of a catalytic antibody with a serine protease active site
Deposited on 1994-08-10, released 1994-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.186
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eapA (A:)
    dieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkgprllihytstllpgips
    rfrgsgsgrdysfsisnleggdiatyyclqyynlrtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgseraqgvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eapB (B:)
    evqlqesgtelvkpgasvkisckasgyistdhaihwvkqrpeqglewigyispgngdiky
    nekfkvkatltadqssstaymqlnsltsedsavyfckrsyygssyvdywgqgttltvssa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgglsssvhtfpallqsgl
    ytmsssvtvpgggwpsatvtcsvahpassttvdkkl