PDB entry 1ea6

View 1ea6 on RCSB PDB site
Description: n-terminal 40kda fragment of nhpms2 complexed with ADP
Class: DNA repair
Keywords: ghl ATPase, hnpcc, mismatch repair
Deposited on 2001-07-10, released 2001-11-23
The last revision prior to the SCOP 1.75 freeze date was dated 2001-11-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pms1 protein homolog 2
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ea6a1, d1ea6a2
  • Chain 'B':
    Compound: pms1 protein homolog 2
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ea6b1, d1ea6b2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ea6A (A:)
    meraessstepakaikpidrksvhqicsgqvvlslstavkelvensldagatnidlklkd
    ygvdlievsdngcgveeenfegltlkhhtskiqefadltqvetfgfrgealsslcalsdv
    tistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefqrnikke
    yakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvfgqkqlqsli
    pfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfffinrrpcdpa
    kvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeeklllavlktsli
    gmfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ea6A (A:)
    csgqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltle
    alsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvr
    hkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigs
    vfgqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqf
    ffinrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvllqeeklllavlktsli
    gmfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ea6B (B:)
    meraessstepakaikpidrksvhqicsgqvvlslstavkelvensldagatnidlklkd
    ygvdlievsdngcgveeenfegltlkhhtskiqefadltqvetfgfrgealsslcalsdv
    tistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefqrnikke
    yakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvfgqkqlqsli
    pfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfffinrrpcdpa
    kvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeeklllavlktsli
    gmfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ea6B (B:)
    csgqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltle
    alsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvr
    hkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigs
    vfgqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqf
    ffinrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdllqeeklllavlktsl
    igmfd