PDB entry 1e9s

View 1e9s on RCSB PDB site
Description: bacterial conjugative coupling protein trwbdeltan70. unbound monoclinic form.
Deposited on 2000-10-26, released 2001-02-06
The last revision prior to the SCOP 1.61 freeze date was dated 2001-02-06, with a file datestamp of 2001-02-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e9sa_
  • Chain 'B':
    Domains in SCOP 1.61: d1e9sb_
  • Chain 'D':
    Domains in SCOP 1.61: d1e9sd_
  • Chain 'E':
    Domains in SCOP 1.61: d1e9se_
  • Chain 'F':
    Domains in SCOP 1.61: d1e9sf_
  • Chain 'G':
    Domains in SCOP 1.61: d1e9sg_
  • Chain 'H':
    Domains in SCOP 1.61: d1e9sh_
  • Chain 'I':
    Domains in SCOP 1.61: d1e9si_
  • Chain 'J':
    Domains in SCOP 1.61: d1e9sj_
  • Chain 'K':
    Domains in SCOP 1.61: d1e9sk_
  • Chain 'L':
    Domains in SCOP 1.61: d1e9sl_
  • Chain 'M':
    Domains in SCOP 1.61: d1e9sm_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9sA (A:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafvegti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sA (A:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqp
    afvegti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e9sB (B:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sB (B:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpaf
    ve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e9sD (D:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
    nrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sD (D:)
    gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
    svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
    wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
    flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
    wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
    aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
    rdrysalervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e9sE (E:)
    svgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngat
    gtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneir
    ndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfd
    dlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggn
    lfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladalt
    kgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslge
    heverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvplei
    kqfanrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sE (E:)
    svgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngat
    gtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneir
    ndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfd
    dlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggn
    lfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladalt
    kgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslge
    heverdryskntralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrq
    pafve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e9sF (F:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sF (F:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdrysktgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanr
    qpafveg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1e9sG (G:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafvegt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sG (G:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdrysknralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrq
    pafvegt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1e9sH (H:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafvegt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sH (H:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpaf
    vegt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1e9sI (I:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sI (I:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdrysralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpa
    fveg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1e9sJ (J:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sJ (J:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdrysgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqp
    afve
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1e9sK (K:)
    svgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngat
    gtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneir
    ndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfd
    dlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggn
    lfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladalt
    kgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslge
    heverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvplei
    kqfanrqpafve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sK (K:)
    svgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngat
    gtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneir
    ndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfd
    dlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggn
    lfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladalt
    kgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslge
    heverdrysralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpaf
    ve
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1e9sL (L:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafvegt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sL (L:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqp
    afvegt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1e9sM (M:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvple
    ikqfanrqpafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9sM (M:)
    nsvgqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvnga
    tgtgksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffnei
    rndydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatf
    ddlrgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpngg
    nlfitwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladal
    tkgrkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslg
    eheverdrysgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqp
    afveg