PDB entry 1e9o

View 1e9o on RCSB PDB site
Description: Crystal structure of bovine SOD - 1 of 3
Class: oxidoreductase
Keywords: oxidoreductase, sod, enzyme, superoxide, asymmetry
Deposited on 2000-10-25, released 2000-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E9O
      • conflict (3)
      • conflict (9)
      • conflict (89)
    • Uniprot P00442 (1-151)
    Domains in SCOPe 2.07: d1e9oa_
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E9O
      • conflict (75)
      • conflict (134)
    • Uniprot P00442 (1-151)
    Domains in SCOPe 2.07: d1e9ob_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9oA (A:)
    matsavcvlsgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsag
    phfnplskkhggpkdeerhvgdlgnvtadsngvaivdivdplislsgeysiigrtmvvhe
    kpddlgrggneestktgnagsrlacgvigiak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9oA (A:)
    atsavcvlsgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadsngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e9oB (B:)
    matkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsag
    phfnplskkhggpkdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhe
    kpddlgrggneeststgnagsrlacgvigiak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9oB (B:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneeststgnagsrlacgvigiak