PDB entry 1e9i

View 1e9i on RCSB PDB site
Description:
Deposited on 2000-10-17, released 2001-03-15
The last revision prior to the SCOP 1.65 freeze date was dated 2001-11-26, with a file datestamp of 2001-11-26.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.229
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e9ia1, d1e9ia2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e9ib1, d1e9ib2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e9ic1, d1e9ic2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e9id1, d1e9id2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9iA (A:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9iA (A:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e9iB (B:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9iB (B:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e9iC (C:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9iC (C:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasedgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgfayq
    tkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakdagy
    tavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekapyng
    rkeik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e9iD (D:)
    skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
    kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
    aaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvke
    airmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkdi
    tlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdgf
    ayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmakd
    agytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgekap
    yngrkeikgqa