PDB entry 1e94

View 1e94 on RCSB PDB site
Description:
Deposited on 2000-10-07, released 2000-11-17
The last revision prior to the SCOP 1.57 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2543
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1e94a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1e94b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1e94c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1e94d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1e94e_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1e94f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e94A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e94B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e94C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e94D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e94E (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94E (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e94F (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e94F (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil