PDB entry 1e8v

View 1e8v on RCSB PDB site
Description: structure of the multifunctional paramyxovirus hemagglutinin- neuraminidase
Deposited on 2000-10-01, released 2001-04-03
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-03, with a file datestamp of 2001-04-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e8va_
  • Chain 'B':
    Domains in SCOP 1.57: d1e8vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8vA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8vB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilknd