PDB entry 1e8t

View 1e8t on RCSB PDB site
Description: structure of the multifunctional paramyxovirus hemagglutinin- neuraminidase
Deposited on 2000-10-01, released 2001-04-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-03, with a file datestamp of 2001-04-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1e8ta_
  • Chain 'B':
    Domains in SCOP 1.59: d1e8tb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8tA (A:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilknd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8tB (B:)
    gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
    hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
    plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
    ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
    fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
    allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
    lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
    siaeisntlfgefrivpllveilkndgvr