PDB entry 1e8j

View 1e8j on RCSB PDB site
Description: solution structure of desulfovibrio gigas zinc rubredoxin, nmr, 20 structures
Class: electron transport
Keywords: electron transport, zinc-substitution, thermostability
Deposited on 2000-09-21, released 2001-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e8ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8jA (A:)
    mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq