PDB entry 1e8e

View 1e8e on RCSB PDB site
Description: solution structure of methylophilus methylotrophus cytochrome c''. insights into the structural basis of haem-ligand detachment
Class: oxidoreductase(cytochrome)
Keywords: cytochrome c'', ligand detachment, redox-bohr effect, paramagnetic
Deposited on 2000-09-20, released 2001-09-20
The last revision prior to the SCOP 1.75 freeze date was dated 2001-09-20, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c''
    Species: Methylophilus methylotrophus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e8ea_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8eA (A:)
    dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
    gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
    kptk