PDB entry 1e7z

View 1e7z on RCSB PDB site
Description: crystal structure of the emap2/RNA binding domain of the p43 protein from human aminoacyl-tRNA synthetase complex
Class: RNA binding domain
Keywords: RNA binding domain, ob-fold, tRNA synthetase complex
Deposited on 2000-09-13, released 2000-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.221
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothelial-monocyte activating polypeptide II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12904 (0-165)
      • cloning artifact (0)
    • PDB 1E7Z (166-End)
    Domains in SCOPe 2.03: d1e7za_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7zA (A:)
    akpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrm
    villcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnp
    kkkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7zA (A:)
    akpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrm
    villcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnp
    kkkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhh