PDB entry 1e7z

View 1e7z on RCSB PDB site
Description: crystal structure of the emap2/rna binding domain of the p43 protein from human aminoacyl-trna synthetase complex
Deposited on 2000-09-13, released 2000-11-27
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-06, with a file datestamp of 2001-02-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e7za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e7zA (A:)
akpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrm
villcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnp
kkkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhh