PDB entry 1e7t

View 1e7t on RCSB PDB site
Description: human vimentin coil 2b fragment linked to gcn4 leucine zipper
Deposited on 2000-09-07, released 2001-09-06
Made obsolete by 1gk6 on 2003-03-27

The last revision prior to the SCOP 1.63 freeze date was dated 2001-09-06, with a file datestamp of 2001-09-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1e7ta_
  • Chain 'B':
    Domains in SCOP 1.63: d1e7tb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7tA (A:)
    mkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrkllegees
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7tB (B:)
    mkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrklleg